PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030824
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 181aa    MW: 19969.9 Da    PI: 8.2237
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030824genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF732.4e-231965349
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 i   s  qvtfskRr+g++KKA+EL++LC++e+avi+fs+ gk+y +
  Lus10030824 19 ILKRSHLQVTFSKRRAGLFKKASELCTLCGVEIAVIVFSPAGKIYSF 65
                 5566778**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.726969IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-26968IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-171131IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.29E-241281IPR002100Transcription factor, MADS-box
PfamPF003196.8E-251865IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-173146IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-174667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MASNKPSNNS PQKLPIKKIL KRSHLQVTFS KRRAGLFKKA SELCTLCGVE IAVIVFSPAG  60
KIYSFGHSDV VSIVRKFLTS AVSHHPPSVE APSQITPEAR ELNAELTLVL SELEVERKQG  120
EVLDRMLKAQ EAEYGLSIAT LGLDGLARLR NALEELQLNV ENQKISEGYE YGNFSENWSF  180
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088151.13e-50PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A067KN982e-46A0A067KN98_JATCU; Uncharacterized protein
STRINGGLYMA20G27350.21e-43(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.19e-30AGAMOUS-like 61